?

Biochemistry

Free Version

Upgrade subject to access all content

Easy

Amino Acid Nomenclature

BIOCHM-BYUT14

Which of the following options represents this peptide sequence – Ala-Ala-Ser-Cys-Thr-Phe-Tyr-Trp-Glu-Gln-Glu-Gly-Pro-His-Arg-Asp-Lys-Asn-Leu-Iso-Lys-Arg-Ala-Ala-Pro-Pro-Phe-Gly-Gly-Gly-His-Glu — in the one-letter amino acid nomenclature?

A

AASCTFYWEQEGOHRDKNLIKRAAOOFGGGHE.

B

AASCTFYWEQEGPHRDKNUIKRAAPPFGGGHE.

C

AASCTFYWQEQGPHRDKNLIKRAAPPFGGGHE.

D

AASCTFYWEQEGPHRDKNLIKRAAPPFGGGHE.